SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

74.125.226.68

Site: "74.125.226.68"
IP Address:
IP Location: Unknown IP



SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
kinoline com ua
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Isohunt.com: isoHunt - the BitTorrent and P2P search engine

Bit Torrent search engine, with an awesome P2P community sharing comments and ratings in discovering new media.
Keywords: isohunt; torrent; iso hunt; torrents; torrent search; diario marca; iso; diario el mundo; pthc; bittorrent;

Kinoline.com.ua:

Keywords: kinoline com ua; kinoline com ua;

Markosweb.com: SmartViper - domain worth analyzer, historical statistics. Knowledge Is Power

SmartViper.com - collection and analysis of data from domains and niches. Comparative characteristic and tracing of important statistic parameters
Keywords: meteo it; www youravon com; google.es; tgcom; pagine bianche; google es; programme tv; vnexpress; google pl; youravon com;

Similarsites.com: SimilarSites.com - Easily Find Similar WebSites

Easily find more sites like those you like. Similar Sites helps you find related sites and alternatives based on community recommendations and computer analysis.
Keywords: similar; mp3 raid; dalealplay; find websites; find sites; tb50; similar websites; k proxy; find similar sites; find web sites;

Vk.com: VK | Welcome!

VK is an all-purpose tool for finding friends, both old and new. Our goal is to keep old friends, ex-classmates, neighbours and co-workers in touch.
Keywords: vk; vkontakte; angel wife lover; angel's wife lovers; deuka; jabber xmpp; help php page; restore access; angels wife lover; restore profile;
 1 
Other top sites:   freelaptopsforcollegestudents.blogspot.com     cookcommunityclassic.com.au     katrinapierson.com     pkk.njth-am.is.com     konna23.wordpress.com     donaldtrumpbankruptcynews.com   
Recently processed sites:   digital-camera-with-gps-capability.buy-camerasupply.com     digitalcamerawithmacrolensreviewz.blogspot.com     digitalcamerawithvideo.bizrate.com     digitalcamerawithviewfinder.ledhdtvsaleprice.com     digitalcameraworld.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9