SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
annemansfieldfengshui.com
Title: Anne Mansfield ~ Moon Gate Feng Shui ~ Home
Description: Anne Mansfield is a certified Five Element Feng Shui Practitioner in the Form School tradition and a student of the Lotus Institute in Seattle, Washington. (www.lotusinstitute.com). She is the founding director and advisor to the Oregon Chapter of the International Feng Shui Guild and is it's Western Regional Director.

Site: "annemansfieldfengshui.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: n nn


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
anne mansfield
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Anniesullivan.org: Annie M. Sullivan

The Sullivan Foundation is dedicated to presevering and honoring the memories of Annie Sullivan and Hellen Keller.
Keywords: annie sullivan; sullivan keller; anne mansfield sullivan; sullivan annie; annie sullivan pictures; annie m; teacher play; picture of annie sullivan; sullivan foundation; anne mccrary sullivan;

En.wikipedia.org: Wikipedia, the free encyclopedia
Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Ifsguild.org: The International Feng Shui Guild for Feng Shui consultants, schools, Directory

The International Feng Shui Guild is home to the largest Feng Shui Consultant and Feng Shui school directory. Providing Feng Shui resources, Feng Shui tools, and opportunities about Feng Shui for the public and our Professional members.
Keywords: feng shui training; western school of feng shui; western school of feng shui; lisa montgomery; feng shui certification; feng shui schools; patricia ripley; feng shui school; terah kathryn collins; advertise products;

Linkedin.com: LinkedIn: Relationships Matter

LinkedIn strengthens and extends your existing network of trusted contacts. ... Stay informed about your contacts and industry. Find the people & knowledge you ...
Keywords: linkedin; credit mutuel; pages jaunes; la banque postale; linkedin; tiscali; pages jaunes; sahibinden; meetic; yves rocher;

Lkwdpl.org: Lakewood Public Library (Lakewood, Ohio)

Information about library services and programs, Lakewood City Schools, the community of Lakewood, Ohio, and local institutions and organizations.
Keywords: sojourner truth; oakley; wilma rudolph; wilma rudolph; bethune; lakewood; eleanor roosevelt; famous women in history; famous women in history; bethune;

Roosevelt.edu: Roosevelt University
Keywords: roosevelt; roosevelt university; rosevelt; universities; colleges in chicago; roosevelt.edu; chicago university; universities in chicago; roosevelt college; roosevelt university chicago;
 1 
Other top sites:   modasuo.com     m4.yghul.ce.ms     easysl.com     melroseplc.net     familytherapygroup.org     gulfcoast.travelhero.com   
Recently processed sites:   black-friday-dumbell-sets-2012.3owl.com     blackfridayduracelldpp600hdpowerpack9.blogspot.com     blackfridaydvdmovies.com     blackfridaydvdplayersales.blogspot.com     blackfridaydvdplayers.cheapprice47.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9