SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
avonbulbs.co.uk
Title: Avon Bulbs - Mail Order Flower Bulbs
Description: Buy snowdrops online from Avon Bulbs - mail order galanthus

Site: "avonbulbs.co.uk"
IP Address: 89.234.26.221
IP Location: United Kingdom

This site within Alpha Directory: v vo


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Apps.rhs.org.uk: Home / RHS Gardening

The website of Britain's gardening charity - the Royal Horticultural Society (RHS) - is the gateway to gardening. The RHS is the world's leading horticultural organisation and the UK's leading gardening charity. Our aim is to protect Britain's gardening heritage and help gardeners everywhere
Keywords: rhs plant finder; royal horticultural society; rhs plantfinder; rhs plants; beech hedging; garden finder; rhs gardening; www.rhs.org.uk; rhs plant; pleached hedge;

Bulbsociety.org: International Bulb Society
Keywords: lilium; allium; oxalis; scilla; freesia; alstroemeria; tulipa; agapanthus; cyclamen; galanthus;

Ces.ncsu.edu: North Carolina Cooperative Extension: Home

North Carolina Cooperative Extension
Keywords: trees; bugs; nutria; june bugs; peonies; plants seeds; bearded iris; apple trees; katsura; ncsu;

En.wikipedia.org: Wikipedia, the free encyclopedia
Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Kew.org: Royal Botanic Gardens, Kew - Home Page

The Royal Botanic Gardens, Kew is one of the world's leading botanic gardens. Holding over 1 in 8 of known plant species, the gardens at Kew and Wakehurst Place offer a unique day out in stunning surroundings. The site also offers information about Kew's science and access to its databases.
Keywords: kew gardens; kew; kew; kew garden; royal botanic gardens kew; royal botanic gardens; royal botanic gardens; kew garden; garden london; london gardens;

Missouribotanicalgarden.org: Missouri Botanical Garden
Keywords: st louis botanical garden; scientists name; scientist name; prehistoric bugs; missouri botanic garden; missouribotanicalgarden;

Pacificbulbsociety.org: Pacific Bulb Society | Home Page
Keywords: curcuma; freesia; agapanthus; pelargonium; alstroemeria; nerine; fresia; scilla; oxalis; muscari;

Theplantexpert.com: The Plant Expert
Keywords: muscari; violets; snowdrops; snowdrop; african violets; african violet; spring flowering bulbs; scilla; parrot tulip; windflowers;
 1 
Other top sites:   thecrookedbilletwimbledon.com     nicolemlavoi.com     farmhouseinn.org     partnersforyouth.org     maureenmckade.com     testcor.com   
Recently processed sites:   raffleticketsoftware.com     raffletickets.org     raffle-tickets.software.informer.com     raffleticketstemplatefreeadv.wordpress.com     raffleticketstemplatemku.wordpress.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9