SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
brazil.pg.netcrafters.com

Site: "brazil.pg.netcrafters.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: r ra


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
p&g brazil
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Annualreport.pg.com: PG.com
Keywords: pg.com; www.pg.com; p&g.com; online annual report; www pg; p&g products; p&g stock; proctor and gamble com; p&g company; ar international;

Cosmeticsdesign.com: Cosmetics Design North America - Cosmetics Packaging, Industry, Manufacturers - Cosmetics Ingredients, Supply

Daily news on cosmetics industry and manufacturers in North America. Free access to news on cosmetics packaging, supply, ingredients, cosmeceuticals and labelling.
Keywords: oriflame; l occitane; cosmetic design; cosmetics packaging; jane cosmetics; univar; liz earle products; perfume packaging; cosmetics news; beauty bank;

Csdw.org: PG.com
Keywords: safe drinking water; children water; clean drinking water; childrens safe; safe drinking; pur water; children safe; pg.com; safe children; drinking safe water;

Features.blogs.fortune.cnn.com: FORTUNE Features - Fortune on CNNMoney.com

... joke that shortsellers called in the fire alarm and a couple of bomb threats. Funny? ... Renewable Energy balanace sheets Bank of America Bank of New York Mellon ...
Keywords: fortune; fortune magazine; mortagages; hot rides; david vs. goliath; hira; bill gates net worth; hira; bill gates net worth; milberg weiss;

Jobs-pg.com: Jobs P&G | Sales | Engineering | Manufacturing | R&D | Procter & Gamble
Keywords: pg.com; fachkraft für lagerlogistik; procter and gamble careers; procter and gamble careers; proctor and gamble careers; proctor and gamble careers; intellectual property jobs; assistant brand manager jobs; property jobs; procter and gamble mexico;

Online.wsj.com: Business News & Financial News - The Wall Street Journal - WSJ.com

WSJ online coverage of breaking news and current headlines from the US and around the world. Top stories, photos, videos, detailed analysis and in-depth reporting.
Keywords: google; bank o f america; bank of america; netflix; wall street journal; wells fargo; wsj; bankofamerica; yahoo; ebay;

Pg.com: PG.com
Keywords: p g; pg; proctor and gamble; procter & gamble; p&g; procter and gamble; tom tailor; procter; terms and conditions; procter gamble;

Securities.com: Research, News, M&A, Statistics, Economic Indicators, Islamic Finance - ISI Emerging Markets

ISI Emerging Markets is the premier provider of information for Research, Financial News, M&A, ECM, DCM, Economic Indicators, Company Profiles, Industry Research, and Shariah Compliant Islamic Finance.
Keywords: securities; isi emerging markets; internet securities; isi emerging markets; securities.com; securities com; securities.com; www securities com; www.securities.com; emerging markets;

Seekingalpha.com: Stock Market News, Opinion & Analysis, Investing Ideas -- Seeking Alpha

Long and short investing ideas, stock quotes, market news, analysis, blogs, and free conference call transcripts.
Keywords: s; 's; ebay; f; aapl; c; goog; b a; ba; aig;
 1 
Other top sites:   doodleb.com     bossyfeet.com     abacusreview.com     greenlite.ca.goodboog.com     craftastic.com     dogdirtdoctor.com   
Recently processed sites:   oscardelarentashades.shopzilla.com     oscardelarenta.shopzilla.com     oscardelarentasimply.info     oscardelarentasimplysweetchemise.info     oscardelarentasleepwear.bizrate.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9