SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

chriscronin.com
Title: Yahoo! Domains Web Card
Description:

Site: "chriscronin.com"
IP Address: 216.39.57.104
IP Location: United States

This site within Alpha Directory: h hr


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
chris cronin
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Croninpainting.com: Chris Cronin Painting and Staining

Chris Cronin Painting and Staining was incorporated in 1991, and has been a professional painting contractor for twenty-eight years. We pride ourselves in being a family owned company who delivers the outstanding work you deserve through attention to detail, skilled craftsmanship, and the finest products available on the market for both the interior and exterior of your home.
Keywords: chris cronin;

Eaglerockfinancial.net: Eaglerock Financial, Inc.

Eaglerock Financial, Inc. is a full service financial consulting firm specializing in money management, financial planning services, basic tax preparation, retirement planning, insurance services and full debt analysis. Securities, financial planning and advisory services offered through LPL Financial, Member FINRA/SIPC, a Registered Investment Advisor.
Keywords: eagle rock insurance;

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Ibdb.com: IBDB: The official source for Broadway Information

The official source for Broadway information, statistics, dates, cast, crew and creative staff credits, roles and related facts
Keywords: broadway; broadway; spring awakening; hairspray; spamalot; little shop of horrors; the phantom of the opera; avenue q; cabaret; original broadway cast;

Imdb.com: The Internet Movie Database (IMDb)

IMDb: The biggest, best, most award-winning movie site on the planet.
Keywords: imdb; xxx; imdb; imdb; cars; imdb; taylor lautner; face; imdb; m;

Twitter.com: Twitter: What are you doing?

Keywords: facebook; google; g m a i l; gmail; you tube; twitter; orkut; hotmail; expedia; gmail com;

Vimeo.com: Vimeo, Video Sharing For You

Vimeo is a respectful community of creative people who are passionate about sharing the videos they make. We provide the best tools and highest quality video in the universe.
Keywords: gmail com; vimeo; vuelo; globo; météo; sky; cartel de santa; hi; meebo; meteo;
 1 
Other top sites:   campwoodsgrounds.com     joerizzaacura.net     theanimalsrunthefarm.blogspot.com     rewardingways.com     mathix.fr     education.atnext.com   
Recently processed sites:   maineislandliving.com     maineislandproperties.com     maineislandragrugs.com     maineislandtreasures.com     maineisokernfireplaceandchimneydealer.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9