SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
citymaker.com
Title: Online web site builder, website software, homepage creator, personal ecommerce - CityMaker.
Description:

Site: "citymaker.com"
IP Address: 69.90.45.76
IP Location: Canada

This site within Alpha Directory: i it


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Doodlekit.com: Free Website Builder | Website Maker | Website Creator

DOODLEKIT™ Online Free Website Builder is perfect for startups & small business websites. Built-in Google, Yahoo, and MSN website SEO ranking tools. No coding. Do-it-yourself. Save money.
Keywords: free website builder; free website builder; website creator; website creators; website builders; website maker; online website builder; free website maker; online website creator; online website builders;

Magix.com: Musiksoftware, Fotosoftware, Videosoftware vom Marktführer - MAGIX

Multimedia Software zur Bearbeitung und Erstellung von Fotos, Videos und Musik - Videos schneiden, Diashows und Musik aufnehmen ist nun kein Problem mehr!.
Keywords: magix; homepage erstellen; music maker; movie software; magix music maker; magix video deluxe; video editing software; magix video; multimedia software; audio video software;

Magix-online.com: MAGIX Online Welt

Erstellen Sie kinderleicht eigene hochwertige Webseiten und beeindruckende Online Alben ohne Vorkenntnisse mit dem preisgekrönten MAGIX Website Maker.
Keywords: website maker; websitemaker; magix website maker; magix fotos; magix photo; magix online; website makers; magix foto; internetseite erstellen; video album;

Softpedia.com: Free Downloads Encyclopedia - Softpedia

Free Downloads Encyclopedia
Keywords: spyware blockers; internet explorer 7; softpedia; everest; internet explorer 8; foxmail; outlook express; microsoft office 2007; avira; disc burner;

Thewindowsclub.com: Windows 7 Tips, Downloads, Security, News, Phones, Office, Live.

Windows 7 tips, tricks, tutorials, news, downloads, Internet Explorer, Windows Phone, Live, Office, Security Tips.
Keywords: club internet; internet explorer problems; actualizar internet explorer; the windows; windows installer cleanup utility; tweakui; msn japan; windows installer cleanup; changer; internet connection problems;

Virtualmechanics.com: Visual Web Design Tool | Website Building Software

SiteSpinner web building tool is also a complete web design software suite that makes it easy to create and publish professional websites. Download a free trial today!
Keywords: website designing software; website designer software; web page maker; web page builder; dwarf; free website builder; website design software; web design software; website building software; web page design program;
 1 
Other top sites:   beltscarf.com     whitesierra.com     home-gym-review.net     faithandwater.blogspot.com     alfrescohomeandgarden.com     trivenetolavoro.it   
Recently processed sites:   kemperkontakt.de     kemperlakesgolf.com     kemperle.net     kemperlesnik.com     kempermarshmillardfamilychapels.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9