SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

elanhotel.co.uk
Title: Places to stay in Mid Wales - The Elan Hotel, Rhayader, Powys (Mid Wales).
Description: Looking for places to stay in Mid Wales? The Elan Hotel, Rhayader, Powys (Mid Wales) offers superb comfort in the heart of the Welsh countryside. The Elan Valley Lakes, Wye Valley Walk and Sustrans National Cycle route are some of the attractions on our doorstep.

Site: "elanhotel.co.uk"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: l la


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
elan hotel
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Booking.com: Booking.com: 105000+ hotels worldwide. Book your hotel now!

Save up to 75% on hotels in 15,000 destinations worldwide. Read hotel reviews and find the guaranteed best price on a choice of hotels to suit any budget.
Keywords: booking; bookings; berlin hotels; hotels berlin; www.booking.com; hotels hamburg; barcelona hotels; prague czech republic hotels; bookings.com; madrid hotels;

Chateauelan.com: Chateau Elan : Luxury Atlanta Hotel, Winery, Golf, Spa. Premier Meeting, Event, and Wedding Destination.

Chateau Elan : Luxury Atlanta Hotel, Winery, Golf, Spa. Premier Meeting, Event, and Wedding Destination.
Keywords: chateau elan; chateau; château; atlanta resorts; braselton ga; braselton georgia; georgia wineries; chateau golf; chateau elon; chateu;

Hotels.com: Hotels.com - Hotel rooms with reviews. Discounts and Deals on 85,000 hotels worldwide

Choose from luxury to cheap, B&B to 5 star hotels. Read reviews, detailed descriptions, maps and quality photos. Book today and save with our Price Match Guarantee.
Keywords: hotel; hotels; hotels.com; hotels com; hotels.com; hotels com; hotels.com; hotels.com; hotels.com; hotel.com;

Luxehotels.com: Luxe Worldwide Hotels: Collection of Luxury Hotels for Business and ...

Our portfolio of luxury hotels is ideal for both leisure and business travel. ... Then it's time for you to discover Luxe Worldwide Hotels. ...
Keywords: listel; hotel midtown atlanta; hotel midtown; luxe; luxe hotels; adria; lux hotels; hotel monterey la soeur osaka; atlanta hotel; worldwide hotels;

Tripadvisor.com: Reviews of vacations, hotels, resorts, vacation and travel packages - TripAdvisor

TripAdvisor - Unbiased hotel reviews, photos and travel advice for hotels and vacations - Compare prices with just one click.
Keywords: london flight; london hotels; rome hotels; paris hotels; stockholm flight; venice hotels; new york city hotels; hotel; los angeles cheap flights; barcelona hotels;

Twitter.com: Twitter: What are you doing?

Keywords: facebook; google; g m a i l; gmail; you tube; twitter; orkut; hotmail; expedia; gmail com;

Yelp.com: San Francisco Restaurants, Dentists, Bars, Beauty Salons, Doctors

San Francisco - User Reviews and Recommendations of Top Restaurants, Shopping, Nightlife, Entertainment, Services and More at Yelp
Keywords: fb; yelp; bus stop; neiman marcus; cuatro; wamu com; la cuarta; restaurants; chicago il movers; regions bank;
 1 
Other top sites:   victoria-newton.free-granny-porn.info     dejectpanda.co.cc     kristincollinswriting.com     useddieselpushers.com     acp.eugraph.com     erincarlylephotography.com   
Recently processed sites:   sassimi.com     sassimivailblackspawrap.oscardelarentasimplysweetchemise.info     sassinak.deviantart.com     sassine400.indieannablog.com     sassinessawomansbestasset.blogspot.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9