SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

focustele.com
Title: Focus Business Answering Service - Telephone answering service for your answering needs.
Description: Business Answering Service providing 24 hour telephone answering services, live operator answering service, virtual receptionist, call center, order taking, voice mail, appointment scheduling, catalog order entry, reservations, technical support, and messaging as part of our live operator services at Focus Telecommunications located in Maryland.

Site: "focustele.com"
IP Address: 209.237.150.20
IP Location: United States

This site within Alpha Directory: o oc


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Outsourcing Services
Outsource Customer Service With award winning company. Get a quote www.focustele.com/
24 7 Answering Service
www.focustele.com/
Award Winning Call Center
www.focustele.com/
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Answeramerica.com: Telephone Answering Service - AnswerAmerica Telephone Answering Services

National and local telephone answering service. Leading provider of telephone answering services to thousands of companies in the United States and Canada.
Keywords: telephone answering service; telephone answering services; telephone answering; phone answering services; answering service telephone; phone answering service; answering phone service; telephone answer service; national answering service; american answering service;

Answerconnect.com: Answering Service, 24x7 Phone Answering | AnswerConnect.com™

Answering Service - Looking for an answering service price quote? Download our free phone answering pricing sheet today - AnswerConnect.
Keywords: telephone answering service; telephone answering services; phone answering service; answering services; answering service; answeringservice; phone answering services; call answering service; dilbert; business phone answering service;

Answerunited.com: Telephone Answering Service | Inbound Call Center | Phone Answering Services | AnswerUnited.com

Keywords: telephone answering service; answering services; answering service; telephone answering; answeringservice; telephone answering services; phone answering service; medical answering service; live answering service; phone answering services;

Appletreeanswers.com: Professional Telephone Answering Services & Call Center Service: Appletree Answering Service

Appletree Answering Services offers 24 hour professional telephone answering services and call center service with live call center agents.
Keywords: answering services; appletree; answering service company; telephone answering service; telephone answering services; appletree answering service; answering service; 24 hour answering service; professional answering service; business phone answering service;

Callexperts.com: Call Experts - Inbound call center solutions, live answering service, and more

Call Experts is a leader in the in-bound call center industry, offering voicemail, e-mail delivery, order taking and live operator services
Keywords: live answering; live call handling; answering calls; live answer; live call center; incoming call center management; call handling scripts; help desk call handling scripts; help desk call handling; hvac answering service;

Efls.com: Answering Service,Telephone Answering Services,Phone Answering Service,Live Answering Service

Answering Service provides telephone answering services,phone answering service,and live operator answering services to businesses and individuals
Keywords: telephone answering service; answering service; answering services; answeringservice; telephone answering services; telephone answering services; business answering service; answering service telephone; live answering service; answering service telephone;

Mapcommunications.com: Answering Service, Virtual Call Center, Live Medical Phone Services

MAP Communications, an answering service provider since 1990, offers customized phone answering services, including medical answering service, to clients in a variety of industries. Sign up for a free trial from the virtual call center.
Keywords: answering services; answering service; answeringservice; answering service companies; telephone answering services; 24 hour answering services; map mobile; live answering service; physician answering service; medical answering;

Specialtyansweringservice.net: Answering Service, Call Center, Phone Answering | Specialty Answering Service

Answering service specializing in call center services including inbound call center and phone answering service support.
Keywords: answering services; physician answering services; call answering service; physicians answering service; real estate answering service; physician answering service; answering service company; telephone answering services; call center services; call answering services;

Telassistant.com: Live Answering Service | Remote Receptionist | Virtual Secretary

TelAssistant is a complete remote call center solution, offering live answering service, receptionist and secretarial staff, executive assistants, ...
Keywords: answering service companies; office answering service; virtual answering service; virtual secretaries; cheap virtual office; virtual answering services; remote receptionists; virtual phone answering; professional answering services; virtual answering;

Voicenation.com: VoiceNation | Voicemail, Virtual PBX, and Answering Services

Experience the most advanced voicemail service available. From web integration to business intelligence, we define what's next in voice communication.
Keywords: answering service; answering services; answeringservice; live answering service; telephone answering service; voicemail service; virtual pbx; phone answering service; voicemail; virtual voicemail;
 1 
Other top sites:   abigailwashburn.com     topblues.com     parrottraining.com     myreels.com     go-last-minute.com     ourcraftycreations.com   
Recently processed sites:   blackandwhitedamasknapkinslwu.wordpress.com     blackandwhitedamaskpapernapkinsvnxb.wordpress.com     blackandwhitedamasktableclothiwgi.wordpress.com     blackandwhitedamaskwallpapera.wordpress.com     blackandwhitedancefloor.co.uk   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9