SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

gallery.archives.govt.nz
Title: Online Regional Exhibitions
Description: This website has been developed to highlight items from the collections of Archives New Zealand. Currently galleries from the Christchurch and Dunedin Regional Offices are available through this gateway, with galleries from other Offices to be added in the future. Archives New Zealand holds approximately 86 kilometres of archives and over half a million maps and plans over four offices. Th

Site: "gallery.archives.govt.nz"
IP Address: 210.48.106.37
IP Location: New Zealand

This site within Alpha Directory: a al


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
heron 23
john charles walters
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Altrec.com: Altrec.com - The North Face, Patagonia, Backpacks, Running Shoes, Camping Equipment, Oakley Sunglasses

Get free shipping on oakley sunglasses, north face backpacks and more. We stock running shoes, camping equipment and gear from only the best brands.
Keywords: women's bags; sandals; north face; jackets; oakley; patagonia; fleece jackets; board shorts; backpacks; ski pants;

Backcountry.com: Backcountry.com: The North Face, Mountain Hardwear and Arc'teryx Skiing, Camping, Hiking and Backpacking Gear

Find the foremost selection of The North Face, Mountain Hardwear, Arc'teryx, and Patagonia skiing, camping, hiking, and backpacking gear on Backcountry.com. As the premier online outdoor gear retailer, we offer a 100% satisfaction guarantee and free shipping.
Keywords: casual watches; backcountry; backpacks; north face; down jacket; backcountry com; backcountry.com; rock climbing shoes; the north face; camping water filter;

Backpacker.com: Backpacker Magazine - Your Backpacking, Hiking, Camping, Outdoor Gear, Adventure Travel, and Skills Magazine

Backpacker Magazine is your source for gear reviews, outdoor skills information and advice, and destinations for backpacking, camping, hiking, and other outdoor activities. Plan trips, download hikes, find gear, and learn outdoor and survival skills
Keywords: camping & hiking; backpacker; backpackers; hiking; backpacking; backpacker magazine; rescue insurance; exped; camping hiking; idaho backpacking;

Backpackinglight.com: BackpackingLight.com -- Home Page

BACKPACKING LIGHT MAGAZINE provides ultralight and lightweight backpacking, climbing, and hiking information, including gear reviews, technique articles, publications, and backpacking gear for the ultralight hiking and mountaineering enthusiast.
Keywords: princeton tec corona headlamp; backpacking; neoair; backpacking light; bpl; superfeet green; tyvek tape; emergency whistle; montane extreme smock; spectra cord;

Groups.yahoo.com: Yahoo! Groups - Join or create groups, clubs, forums & communities

Yahoo! Groups offers free mailing lists, photo & file sharing, group calendars and more. Discuss hot topics, share interests, join online communities.
Keywords: yahoo.com; yahoo groups; www.yahoo.com; ymail; yahoo groups; www.yahoo.com; indian railways; clubs; estrelas; lezbiyen;

Thebackpacker.com: TheBackpacker.com - Backpacking, Hiking And Camping

since 1996, thebackpacker.com has been the online destination for wilderness backpackers and hikers - site includes backpacking gear reviews, hiking trail reviews, hiking tips, message board and more
Keywords: backpacker; camping & hiking; backpacking; backpackers; backpacker magazine; cfp 90; moleskin; katadyn hiker; backpack camping; backpacking trips;

Trailspace.com: Trailspace.com: The Backcountry Gear Guide

Keywords: hypno; woolrich arctic parka; snowshoes; internal frame backpack; hip packs; lowe alpine; patagonia outerwear; camping gaz; approach shoes; sleeping bag liners;
 1 
Other top sites:   beacon-companies.com     acontinentalhaircreations.com     mrilebanon.com     womaninthe21stcentury.wordpress.com     africannubianqueens.com     sertac.org   
Recently processed sites:   naplescreeksoaps.com     naplescriminaldefenselawyer.net     naplescriminallawyers.com     naplescruiseclub.embarqspace.com     naplescruisein.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9