SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

iamtrojan.com

Site: "iamtrojan.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: a am


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
trojan security
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Losangeles.citysearch.com: Los Angeles, CA Metro City Guide - Reviews and Recommendations by Citysearch

The Citysearch® Guide to Los Angeles, CA Metro. Los Angeles, CA Metro restaurants, bars, night clubs, hotels, shops, spas, events, attractions, yellow page listings and more. Find reviews, recommendations, directions and information on all the latest venues and businesses in Los Angeles, CA Metro.
Keywords: bars; los angeles ca; six flags magic mountain; night club; los angeles; the ivy; los angeles california; red lion; katana; night clubs;

Pasword.com: Pasword Protection - Serious Security

Keywords: pasword.com;

Trojansecurities.com: Risk Management, Security Services, Security Training, Bodyguard, Private Security

Risk Management, Security Services, Security Training, Bodyguard, Private Security, Personal Protection, Surveillance, Armed Security, Conflict Resolution, Risk Analysis
Keywords: risk management security; trojan security; private security training; risk security; security trojan; personal security training; hostage rescue training; high security risk; maritime security training; security risk management;
 1 
Other top sites:   ilcapricciowaltham.com     astronomy.darkhorizons.org     galahad.rl.ac.uk     invisiblesandwiches.com     doodleb.com     mdmb.co.uk   
Recently processed sites:   irvinecriminaldefense.com     irvinecriminaldefenselawyer.net     irvinecriminallawyer.com     irvinecrossroadsdental.com     irvinecycles.co.uk   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9