SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

jtoyanelsonbooks.com
Title: J'Toya's Books - Home
Description:

Site: "jtoyanelsonbooks.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: t to


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
toya nelson
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Flickr.com: Welcome to Flickr - Photo Sharing

Flickr is almost certainly the best online photo management and sharing application in the world. Show off your favorite photos and videos to the world, securely and privately show content to your friends and family, or blog the photos and videos you take with a cameraphone.
Keywords: flickr; fb; flikr; photos; austin tx; tuenti; informatique; flickr.com; yahoo.es; yahoo es;

Linkedin.com: LinkedIn: Relationships Matter

LinkedIn strengthens and extends your existing network of trusted contacts. ... Stay informed about your contacts and industry. Find the people & knowledge you ...
Keywords: linkedin; credit mutuel; pages jaunes; la banque postale; linkedin; tiscali; pages jaunes; sahibinden; meetic; yves rocher;

Names.whitepages.com: People Information Home

Free searches for people and businesses in the U.S. and Canada.
Keywords: goggel; john leis; robert long; david gonzales; white pages; john lawyer; robert cook; steven lewis; charles swab; whitepages com;

Pinterest.com: Pinterest / Home

Keywords: pin boards; architectural sections; hedgehog puppet; christine martinez; pinboards; silver toilet seat; comfy couches; michelle flynn; duygu demir; chin wong;

Rockhurst.edu: Rockhurst | Kansas City's Jesuit University

Rockhurst is a Catholic, Jesuit university serving 3,000 students in the business and cultural heart of Kansas City. It is a comprehensive university that offers more than 50 undergraduate and graduate programs taught by nationally recognized faculty.
Keywords: rockhurst university; rockhurst; adp ipay; helzberg; kansas city colleges; rockhurst edu; research college of nursing; helzburg; colleges in kansas city; paystatements adp;

Spokeo.com: People Search | White Pages | Find People | FREE!

People search engine and white pages finds phone, address, email, and photos. Find people for free.
Keywords: people search; find people; email search; reverse email; email lookup; people search white pages; search people; search for people; find people by email; search email;

Whitepages.com: WhitePages - Find People for Free and Connect with Confidence

Find email addresses, phone numbers, and area and zip codes for people and businesses.
Keywords: phone; reverse phone lookup; telephone; white pages; business search; phone number lookup; find people; phone book; people search; phone numbers;
 1 
Other top sites:   irm-adoption.org.uk     livebusinessclass.nl     kingdomsh.com.cn     allmesothelioma.com     pumpkinpiesoup.deviantart.com     zooknic.com   
Recently processed sites:   blackfridaydigitalcamera.bestdealss.info     blackfridaydigitalcameradeals2012.3owl.com     blackfriday-digitalcameradeals2012.blogspot.com     blackfridaydigitalcameraonsale.com     blackfridaydigitalcameraprinterdock.cheapshopsnow.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9