SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

killingenglish.blogspot.com

Site: "killingenglish.blogspot.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: i il


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
sacramento biz journal
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Bizjournalevents.com: Sacramento Business Journal Events

Keywords: sacramento business journal; sacramento business; sacramento business journal online; sacramento biz journal;

Bizjournals.com: Business News | The Business Journals

The Business Journals' sites features local business and industry news from 41 different markets around the nation along with a full menu of tools to help business owners and operators manage their businesses more successfully.
Keywords: warehouse jobs; sales executive jobs; hotel jobs birmingham; highest paying jobs; associated bank; la senza; laser hair removal risk; executive jobs; legal executive jobs; business journal;

Capradio.org: CapRadio | Home | Capital Public Radio

Capital Public Radio
Keywords: radio capital; capital radio; cap radio; capital public radio; record shelf; npr sacramento; capital one radio; dental credit cards; california earthquake insurance; captial radio;

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Sarta.org: Home - SARTA: Sacramento Area Regional Technology Alliance

SARTA is a non-profit organization founded to foster high tech entrepreneurial growth & attract investment capital to the greater Sacramento region.
Keywords: clean start; leadership series; restaurant promotion; majority report; gary simon; sacramento area; clean energy technology; technology alliance; mergers and acquisitions ppt; drexel admission;

Twitter.com: Twitter: What are you doing?

Keywords: facebook; google; g m a i l; gmail; you tube; twitter; orkut; hotmail; expedia; gmail com;

Yelp.com: San Francisco Restaurants, Dentists, Bars, Beauty Salons, Doctors

San Francisco - User Reviews and Recommendations of Top Restaurants, Shopping, Nightlife, Entertainment, Services and More at Yelp
Keywords: fb; yelp; bus stop; neiman marcus; cuatro; wamu com; la cuarta; restaurants; chicago il movers; regions bank;
 1 
Other top sites:   thevoiceoverartist.com     campbellusd.org     guyssunglasses.bcz.com     tmpn.com     studiodimonticelli.com     sonaturalscosmetics.com   
Recently processed sites:   blackfridaydigitalcameraprinterdock.cheapshopsnow.com     blackfridaydigitalcamerasales.info     blackfridaydigitalcamerasales.us     blackfridaydigitalcameras.info     blackfridaydigitalcamerassales2012.3owl.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9