SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

launchsalesandmarketing.wordpress.com
Title: Launch Sales and Marketing LLC – Blog
Description: B2B Outsourced Sales and Marketing - Inside Sales solutions to boost your sales revenue, test the market, sales tips, sales management, reduce internal costs, liability, outsource your sales to Launch Sales and Marketing.

Site: "launchsalesandmarketing.wordpress.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: a au


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
launch sales and marketing
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Crunchbase.com: CrunchBase, The Free Tech Company Database

CrunchBase is the free database of technology companies, people, and investors that anyone can edit.
Keywords: facebook; you tube; google; orkut; amazon; netlog; hi5; meebo; myspace; twitter;

Dailymotion.com: Dailymotion - Online Videos, Music, and Movies. Watch a Video Today!

Keywords: undefined; sibel can; sibel can; poker face; skyblog; daily motion; daily motion; videos; funny accidents; videos musicales;

Launchsalesresults.com: Launch Marketing | Sales & Results

Keywords: launch sales and marketing;

Linkedin.com: LinkedIn: Relationships Matter

LinkedIn strengthens and extends your existing network of trusted contacts. ... Stay informed about your contacts and industry. Find the people & knowledge you ...
Keywords: linkedin; credit mutuel; pages jaunes; la banque postale; linkedin; tiscali; pages jaunes; sahibinden; meetic; yves rocher;

Peopleperhour.com: Find Freelancers - 46,118 Freelance Jobs on PeoplePerHour.com

Advertise your job to over 81,949 talented freelancers at PeoplePerHour.com where we connect skilled experts with thousands of jobs every month. Find freelancers, freelance work & freelance jobs at PeoplePerHour.com
Keywords: rentacoder; freelance jobs uk; per hour; freelance web developer london; remotly anywhere; freelance uk; cad tutor; blister card; telemarketing group; joaquin martinez;

Saleslaunch.com: Saleslaunch.com | Internet Marketing, Lead Generation, Consulting

Keywords: sales launch;

Venturebeatprofiles.com: VentureBeat Profiles - Discover find and share information about new top startups and companies

VentureBeat Profiles is the best way to discover and research new top startups and companies. VentureBeat Profiles is a platform for our community to share, discuss, and evaluate information about these companies.
Keywords: meebo; studivz; dba dk; mbuzzy; mocospace; meboo; nutool; weeworld; ordinateur; trulia;
 1 
Other top sites:   missmissouriusa.com     unicocaravanawning.co.uk     jcyl.es     betterenergyideas.com     trivenetolavoro.it     lindalovelacedeep.com   
Recently processed sites:   westlake_village.explore-california.us     westlakevillagefamilyservices.org     westlakevillageflorist.com     westlakevillage.fourseasons.com     westlakevillagegardenclub.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9