SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

libguides.mskcc.org

Site: "libguides.mskcc.org"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: i ib


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Cornellmedicine.com: Weill Cornell Department of Medicine

Weill Cornell Department of Medicine
Keywords: weill cornell medical college; weill cornell; cornell medical center; cornell hospital; geriatric medicine; weill medical college of cornell university; cornell medical college; cornell hospital new york; weill; cornell medical;

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Library.mskcc.org: Memorial Sloan-Kettering Cancer Center Library

For Memorial Sloan-Kettering's services, programs, staff directory, treatment ... © 2006-09 Memorial Sloan-Kettering Cancer Center Library. 1275 York Avenue New ...
Keywords: memorial sloan-kettering cancer center; memorial sloan kettering cancer center; sloan kettering cancer center; memorial sloan kettering cancer; memorial sloan-kettering cancer; memorial sloan kettering cancer; library memorial; sloan kettering cancer; class registration; sloankettering;

Macfwebext.mskcc.org: Home

Keywords: monoclonal antibody; secreted proteins; secreted protein; monclonal antibody; monoclonal antibodie;

Mskcc.org: Sloan-Kettering - Memorial Sloan-Kettering Cancer Center

For more than a century, Memorial Sloan-Kettering Cancer Center has offered the best possible care for patients with cancer and has sought strategies to prevent, control and ultimately cure cancer in the future. Our continuing record of success in the laboratory and at the bedside attests to our position as one of the nation's premier cancer centers.
Keywords: msk; juice plus; graviola; sloan-kettering; sloan kettering; memorial sloan kettering; zestra; memorial sloan-kettering cancer center; memorial sloan kettering cancer center; cancer hospital;
 1 
Other top sites:   indyflowerama.com     sinimachine.com     cutting-mats.net     174.132.194.125     euroitalia.net     blueeyedragon.com.au   
Recently processed sites:   69.5.5.9     6955.bandcamp.com     6955villageparkway.midassanfrancisco.com     69.56.138.42     69.56.140.150   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9