SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
nikit.co

Site: "nikit.co"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: i ik


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
niki t
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Linkedin.com: LinkedIn: Relationships Matter

LinkedIn strengthens and extends your existing network of trusted contacts. ... Stay informed about your contacts and industry. Find the people & knowledge you ...
Keywords: linkedin; credit mutuel; pages jaunes; la banque postale; linkedin; tiscali; pages jaunes; sahibinden; meetic; yves rocher;

Marinetraffic.com: Live Ships Map - AIS - Vessel Traffic and Positions

Vessel positions tracking based on AIS data. Real-time ship locations and port arrivals departures
Keywords: ais; vessel tracking; ship tracking; traffic com; maps live; live maps; ais live; maps.live; karakartal; marine traffic;

Marshalldennehey.com: Marshall, Dennehey, Warner, Coleman & Goggin

Marshall, Dennehey, Warner, Coleman & Goggin is a defense litigation law firm with more than 250 attorneys representing more than 950 insureds and self-insureds in Pennsylvania, New Jersey, Delaware, West Virginia and portions of Ohio.
Keywords: marshall dennehey; mckissock; marshall attorneys; maritime litigation; thomas o'malley; bad faith litigation; goggin; heimbach; james hanratty; mary doherty;

Myspace.com: MySpace

Get Started On MySpace! Join for free, and view profiles, connect with others, blog, rank music, and much more!
Keywords: myspace; myspace com; myspace.com; my; m y; rihanna; www myspace com; www.myspace.com; meteo; bt;

Pangea.stanford.edu: Main Page | School of Earth Sciences, Stanford University

The Stanford School of Earth Sciences recognizes the need and takes seriously its responsibility to share our understanding of the Earth with the greater community.
Keywords: stanford university; unix commands; data utilities; network security issues; telnet ftp; earth sciences; branner; gas well testing; chris francis; computer configuration;

Smlr.rutgers.edu: School of Management and Labor Relations
Keywords: voos; david p; eaton work; labor relations management; labor relations; ying hong; huselid; phd in human resource management; part time phd program; labor relation;

Soundcloud.com: Welcome - SoundCloud
Keywords: vuelo; hotmail.fr; hotmail fr; gmx.de; cadena ser; ordinateur; oriflame; strichcode; laminat; robyn;

Twitter.com: Twitter: What are you doing?
Keywords: facebook; google; g m a i l; gmail; you tube; twitter; orkut; hotmail; expedia; gmail com;

Youtube.com: YouTube

Upload, tag, and share your videos worldwide on YouTube, and watch other user-submitted videos sorted by most recent, ... hours of video uploaded every ...
Keywords: you tube; google; youtube.com; youtube com; you; www youtube com; www.youtube.com; youtube videos; yotube; david bisbal;
 1 
Other top sites:   socalwinegroup.com     orby-bike-trailer20804.blogspot.com     radiall.nl     car8.ups-tlse.fr     campwoodsgrounds.com     linkingtheupstate.com   
Recently processed sites:   catfightinglinks.com     catfightingmovies.com     catfightingpayperview.com     catfightingpayperview.findallporn.com     catfightingphotos.net   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9