SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
northernculture.org
Title: Sundog Carving Studio - Northern Cultural Expression Society
Description:

Site: "northernculture.org"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: o or


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
northern culture
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Culturenorthernireland.org: Culture Northern Ireland
Keywords: dr.yes; culture northern ireland; mickey harte; impartial reporter; siege of derry; northern ireland culture; charabanc; mickybo and me; bronagh gallagher; culture of ireland;

Digitalspy.co.uk: Showbiz, entertainment and media news - Digital Spy

Entertainment news about the biggest TV shows, films and celebrities, updated around the clock.
Keywords: digital spy; digitalspy; eastenders spoilers; live.co.uk; live co uk; eastenders; alba mode; digital spy soaps; hollyoaks; hollyoaks spoilers;

Enjoyniigata.com: Enjoy-Niigata
Keywords: niigata; niigata; niigata japan; nigata; nigata; naeba ski; grape farm; naeba ski; naeba prince hotel; niigata travel;

En.wikipedia.org: Wikipedia, the free encyclopedia
Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Sasktourism.com: Tourism Saskatchewan Canada

Official website of Tourism Saskatchewan, with information on Saskatchewan travel planning, vacations, fishing, camping, accommodations, hotels, parks, lakes, rivers, hunting, events, and much more. Come to the heart of Canada - come to Saskatchewan.
Keywords: saskatchewan; saskatchewan canada; sask; saskatchewan tourism; saskatchewan flower; saskatchewan map; map of saskatchewan; northern saskatchewan; saskatchewan travel; saskachewan;

Tripadvisor.com: Reviews of vacations, hotels, resorts, vacation and travel packages - TripAdvisor

TripAdvisor - Unbiased hotel reviews, photos and travel advice for hotels and vacations - Compare prices with just one click.
Keywords: london flight; london hotels; rome hotels; paris hotels; stockholm flight; venice hotels; new york city hotels; hotel; los angeles cheap flights; barcelona hotels;
 1 
Other top sites:   intermountaindistrict.org     psyhea.psyf.sfedu.ru     showsensationswesterndesign.com     thisisoscar.blogspot.com     oasisbeachcancun.com     dfred.net   
Recently processed sites:   wasteaminute.com     wasteam.railfan.net     wasteandclimate.org     wasteandrecycle.com.au     wasteandrecyclingmarketplace.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9