SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
ourworkoutroom.com
Title: home | Our Workout Room
Description: Our Workout Room is an out of the box cutting edge fitness studio that will get you the results you have always wanted or Your Money Back.......

Site: "ourworkoutroom.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: u ur


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
workout room
gym pflugerville
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Abc.go.com: Home - ABC.com
Keywords: a b c; abc; lost; v; dancing with the stars; desperate housewives; grey's anatomy; greys anatomy; abc com; abc.com;

Hgtv.com: HGTV - Decorating, Outdoor Rooms, Landscaping Ideas, Kitchen and Bathroom Design : Home & Garden Television

Transform your home with inspiration and instruction from HGTV for your home design, decorating, landscaping and handmade craft project.
Keywords: home & garden; bathroom; kitchen; hgtv; bathrooms; home improvement; bathroom designs; home and garden; home office; window treatments;

Houzz.com: Houzz- Home Design, Decorating and Remodeling Ideas and Inspiration, Kitchen and Bathroom Design

The largest collection of interior design and decorating ideas on the Internet, including kitchens and bathrooms. Over 60,000 inspiring photos and 90,000 idea books from top designers around the world. Remodeling and decorating ideas and inspiration for designing your kitchen, bath, patio and more. Find architects, interior designers and home improvement contractors.
Keywords: kitchen design; modern kitchen; bathroom design; bathroom designs; bedroom designs; bedroom designs; bathroom design; bathrooms; staircase design; staircase design;

Menshealth.com: Men's Health - Men's Guide to Fitness, Health, Weight Loss, Nutrition, Sex, Style and Guy Wisdom

Information on fitness, health, relationships, nutrition, weight-loss and muscle building
Keywords: mens health; fitness; men's health; sex; men; s; 's; menshealth; workout; hot sex;

Nerdfitness.com: Nerd Fitness: Helping You Lose Weight, Get Stronger, Live Better.

Nerd Fitness: A fitness website for nerds and average joes. Helping you lose weight, get stronger, live better.
Keywords: brad pitt troy; bodyweight workout; gatorade electrolytes; body weight workout; how to work out; just fitness; freestyle running; inverted row; inverted rows; workout music playlist;

Shape.com: Shape.com: Diet, Fitness, Recipes, Healthy Eating Expertise

Join our community to learn more about diet, fitness, healthy eating, recipes, beauty and recipes using personalized tools and widgets
Keywords: fitness; shape; shape magazine; shapes; shape.com; shape com; magazines; zumba workout; fitnes; women's fitness magazines;

Tlc.howstuffworks.com: TLC "Guides"

TLC Guides
Keywords: c h r i s t m a s; christmas; dry cleaners; dry cleaning; washing machine; quilt top; floor cleaning; hair replacement; cartoon baby; whitening;

Whitehousemuseum.org: White House Museum
Keywords: bowling alley; oval office; rose garden; solarium; resolute; musicroom; basketball court; white desk; blue room; china room;
 1 
Other top sites:   madlynxfilms.com     randomstabbing.blogspot.com     newmexicobarnbuilders.com     prssa.org.ohio-state.edu     apebhconference.files.wordpress.com     sc-magdeburg.biz   
Recently processed sites:   wasteandrecycle.com.au     wasteandrecyclingmarketplace.com     wasteandrecyclingnews.com     wasteandrecycling.rrc.qld.gov.au     wasteandresources.dk   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9