SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
papillonselect.com
Title: Welcome to Papillon Select Tours, Custom-made European vacations for small groups
Description: Custom-made European vacations for small groups of friends or families. Our 'week-long dinner parties' are based in Provence, Tuscany, Umbria,Lombardy, Basque Country, Burgundy, Bath and beyond.

Site: "papillonselect.com"
IP Address: 67.18.62.138
IP Location: United States

This site within Alpha Directory: a ap


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Agriturismo.net: Tuscany Italy Villas:Tuscany farmhouse accommodation,apartment,hotel,Tuscany Italy vacation,Villa Rental

Agriturismo net offers wide selection of farmhouse, agriturismo and villa accommodation in Tuscany and Italy. Tuscany farm holidays, bed and breakfast, Tuscany villa rentals, apartments and all types of holiday accommodation in Tuscany and throughout the major regions in Italy.
Keywords: agriturismo; agriturismo toscana; tuscany italy; agriturismo in toscana; toscane; tuscany farmhouse; massa carrara; farmhouse tuscany; agriturismo tuscany; farmhouse accommodation tuscany;

Aicipressi.it: Ai Cipressi B&B - Bed & Breakfast - Affittacamere - Zimmer - LUCCA - Toscana - Italia
Keywords: lucca bed and breakfast; bed and breakfast lucca italy; bed breakfast lucca; b&b lucca italy; lucca bed & breakfast; bed&breakfast lucca; bed & breakfast lucca; b&b a lucca; bad and breakfast lucca; bed and breakfast a lucca;

Altuscany.it: AL TUSCANY - Bed&Breakfast in Lucca

Wonderful Tuscany: Accomodations in Lucca, Tuscany
Keywords: bed&breakfast lucca;

Laromea.com: Bed and Breakfast La Romea - For you best accommodation in Lucca Tuscany Italy

Bed and breakfast La romea a Lucca Tuscany italy, for your best accommodation in Lucca
Keywords: b&b lucca; romea; bed and breakfast lucca; accommodation in lucca; bed breakfast tuscany; lucca b & b; la lucca; intimate room;

Luccainvilla.it: Lucca in Villa - Soggiorni a Lucca in Villa con Trattamento B&B

Appartamenti in affitto per soggiorni a Lucca nelle tre Ville: Elisa, San Donato e San Marco, nei pressi del centro della città.
Keywords: villa lucca;

Roomslatorre.com: La Torre Bed & Breakfast - Lucca, Tuscany, Italy - Home

La Torre Bed & Breakfast is located in an historical palace in the heart of medieval Lucca. Here you will find rooms than give you that family-run feeling, offering a calm and relaxing atmosphere. Ours rooms have all the comforts one needs: bath, TV, and some have air conditioning, and some even have a small kitchen included
Keywords: bed and breakfast lucca; lucca bed and breakfast; b&b lucca; accommodation lucca italy; bed and breakfast lucca italy; bed breakfast lucca; torre italy; lucca accommodation; bed & breakfast lucca; accomodation lucca;

Tripadvisor.com: Reviews of vacations, hotels, resorts, vacation and travel packages - TripAdvisor

TripAdvisor - Unbiased hotel reviews, photos and travel advice for hotels and vacations - Compare prices with just one click.
Keywords: london flight; london hotels; rome hotels; paris hotels; stockholm flight; venice hotels; new york city hotels; hotel; los angeles cheap flights; barcelona hotels;
 1 
Other top sites:   blackgirls.porncity.net     radio-scouting.org.uk     hotporntemplates.com     kingsupplyohio.com     slitta.it     sprixx.com   
Recently processed sites:   mcfarlaneactionfigure.shopzilla.com     mcfarlanealvarez.com     mcfarlaneandco.co.uk     mcfarlaneasphalt.com     mcfarlaneasphaltdrivewaypaving.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9