SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

parplink.u-strasbg.fr
Title: The PARP Link Homepage
Description:

Site: "parplink.u-strasbg.fr"
IP Address: 130.79.89.61
IP Location: France

This site within Alpha Directory: a ar


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Aatbio.com: AAT Bioquest

AAT Bioquest status page
Keywords: aat; maleimide; bioquest; novostar; fluorescent peptide; thiol; fluorescent peptides; alkaline phosphatase assay; peptide labeling; fluorescamine;

Abcam.com: Abcam - antibodies and reagents supplier, find any antibody

Abcam - antibodies and reagents supplier, find any antibody
Keywords: abcam; immunoprecipitation; custom antibody; antibodies; sandwich elisa; ab.com; gfp antibody; foxp3 antibody; brdu; facs;

Bioassaysys.com: BioAssay Systems

Keywords: bioassay; bio assay; bioassay system; assay kits; hdl ldl vldl; alkaline phosphatase assay; ldl hdl vldl; ldl vldl; calcium assay; vldl ldl;

Biovision.com: BioVision - Life Science Source | 800-891-9699

BioVision - Life Science Source | 800-891-9699 - Antibodies & Supporting Tools,Cytokines, Growth Factors & Hormones,Apoptosis,Biochemicals,Cell Proliferation & Cytotoxicity,Molecular Biology Tools,Protein Extraction & Purification,Stem Cell Research Tools,Metabolism Assays,Cell Damage & Oxidative Stress,Fluorescent Proteins,Signal Transduction,Proteins and Enzymes,Laboratory Accessories,Protein
Keywords: biovision; apoptosis assay; reporter assay; gfp antibody; cytochrome c apoptosis; myc tag; assay kits; apoptosis assays; gfp vector; pfu polymerase;

Caymanchem.com: Cayman Chemical | Home

Provides biochemicals (eicosanoids ,nitric oxide reagents, related products), EIA kits, cDNA probes and antibodies to researchers worldwide.
Keywords: cayman; cayman chemical; 8 ans; caymen; cayman chemicals; new cayman; caymon; wst 8; mtt assay; cayman company;

Eenzyme.com: eENZYME

Success is easy with the right tools
Keywords: hand centrifuge; hettich; hettich centrifuge; 1 kb dna ladder; screw cap tubes; hettich centrifuges; 96 well pcr plates; rotanta; centrifuge prices; screw cap tube;

Mblintl.com: Welcome | MBL International

Keywords: mbl; bion; biozol; trial size; medikal; mbl international; antibody size; alexa fluor 488; anti m; mbl antibody;

Medibena.at: MEDIBENA Home Page

Life Science, In vitro Diagnostic, Food Safety, Products distribution.
Keywords: chloride assay; salmonella elisa; gapdh elisa; pyruvate assay; glycogen assay; arginase assay; glucosidase assay;

Sigmaaldrich.com: Sigma-Aldrich: Analytical, Biology, Chemistry & Materials Science products and services.

Keywords: sigma; sigma-aldrich; media expert; aldrich; chemicals; aldrich sigma; particle size; shrna; supelco; isotec;
 1 
Other top sites:   lauraromano.net     tacticalsystemsnetwork.com     buybossbrands.mydyn.net     studiobanana.org     thekombuchadiet.com     profed.heartandstroke.ca   
Recently processed sites:   katadyn.it     katadyn-microfilter.buycheapr.com     katadyn-mini.buycheapr.com     katadyn-mini-ceramic.buycheapr.com     katadynminiceramicwaterfilter.n4z.gm9.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9