SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

products.ensto.com
Title: Products | Ensto
Description:

Site: "products.ensto.com"
IP Address: 79.134.121.164
IP Location: Finland

This site within Alpha Directory: r ro


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

De.wikipedia.org: Wikipedia – Die freie Enzyklopädie

Keywords: private krankenversicherung; fernseher; musikinstrumente; videokonferenz; girokonto; wohnwagen; wohnung; girokonto; fahrrad; laserdrucker;

Dict.cc: dict.cc | Wörterbuch Englisch-Deutsch

Englisch-Deutschwörterbuch: Von Benutzern erweiterbares Wörterbuch für die Englisch-Deutsch-Übersetzung. Weitere Wörterbücher für andere Sprachen im Aufbau - mach mit!
Keywords: versicherung; kleidung; englisch deutsch; versicherung; deutsch englisch; gebraucht; übersetzung; was geht ab; kabelverschraubung; einfach;

Dictionary.reverso.net: Online dictionary service in English, Spanish, German and other languages by Collins Lexibase

Keywords: reverso; schlitten; carrello elevatore; sommier; traduction anglais francais; fallar; salle de bain; kinésithérapeute; accueil; copisteria;

En.bab.la: bab.la language portal

Language portal: Look up translations in the dictionary, learn languages easily through hundreds of free quizzes
Keywords: agrarisch; tagesgeldkonto; rachat; penderie; kinésithérapeute; penderie; cartoleria; dictionary english to hindi; paesaggio; paesaggio;

En.dicios.com: Language Dictionaries

Free online language dictionaries for your translations: english, italian, spanish, german, french ...
Keywords: geschäftsführer; renseignement; rekening; repas; schlampe; moyenne; defraudacion; frais; mechant; fertig;

Eudict.com: EUdict | European dictionary

EUdict multilanguage online dictionary, Afrikaans Arabic Catalan Chinese Croatian Czech Danish Dutch English Finnish French German Hungarian Italian Indonesian Japanese Latin Norwegian Polish Portuguese Russian Slovenian Spanish Swedish
Keywords: sonstige; montre; sportske novosti; agencija za privredne registre; agrarisch; dugás; agencija za privredne registre; www google om; sarampion; tücher;

Linguee.de: Linguee – Das Web als Wörterbuch – Deutsch/Englisch

Suchmaschine für viele Millionen Übersetzungen anderer Menschen. Deutsch-Englisch-Wörterbuch mit unzähligen übersetzten Beispielsätzen.
Keywords: übersetzter; fachoberschulreife; fachoberschulreife; übersetzungsmaschine; papierschneidemaschine; währungsumrechnung; runddusche; auslandsauskunft; landesamt für finanzen; leo französisch;

Youtube.com: YouTube

Upload, tag, and share your videos worldwide on YouTube, and watch other user-submitted videos sorted by most recent, ... hours of video uploaded every ...
Keywords: you tube; google; youtube.com; youtube com; you; www youtube com; www.youtube.com; youtube videos; yotube; david bisbal;
 1 
Other top sites:   networkservice.svchost-exe.net     lhsonline.co.uk     saplist.com     basicmri.com     mohit-financial.blogspot.com     ezekielswheelbikes.com   
Recently processed sites:   kansascitycrewbase.homestead.com     kansascity-criminal-attorney.com     kansascitycriminalattorney.net     kansas-city-criminal-defense-attorneys.com     kansascitycriminaldefenselawyer.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9