SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
roslin.tripod.com
Title: Rose's Mark Hamill Image Gallery
Description: This site is dedicated to Mark Hamill and is for his fans! It contains photos and my paintings of him. It also includes some Star Wars and Barbados images.

Site: "roslin.tripod.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: o os


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
mark hamill pictures
mark hamill pictures
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Buddytv.com: BuddyTV - TV News, Videos, Photos, Games and Celebrities

BuddyTV. Read candid news and exclusive spoilers, watch TV videos, share opinions, play fun games, and win free TV prizes!
Keywords: hannah montana; 24; dancing with the stars; so you think you can dance; the bachelor; bachelor; grey's anatomy; desperate housewives; big brother; america's got talent;

Fanpix.net: FanPix.Net - Entertainment Pictures for Fans - Fan Pix, Fan Pics

29 November 2010... One of the internet's largest collection of high quality celebrity photos, movie pictures and music images.
Keywords: dulce maria; angelique boyer; dakota fanning; dakota fanning; salman khan photos; randy orton; sara tommasi; emma watson pictures; maite perroni; michael jackson pictures;

Imdb.com: The Internet Movie Database (IMDb)

IMDb: The biggest, best, most award-winning movie site on the planet.
Keywords: imdb; xxx; imdb; imdb; cars; imdb; taylor lautner; face; imdb; m;

Lonny.com:

Keywords: lonny;

Rottentomatoes.com: ROTTEN TOMATOES: Movies - New Movie Reviews and Previews!

Movie Trailers, Movie Reviews and New Movie Previews from Rotten Tomatoes - The Ultimate Movie Reaction Site!
Keywords: rotten tomatoes; xxx; avatar; twilight; transformers; remember me; shutter island; rt; inception; u p;

Seattlepi.com: Seattle news, sports, events, entertainment | seattlepi.com - Seattle Post-Intelligencer

Seattle local news, sports, photos, events listings plus the largest collection of community and special interest blogs from in and around Seattle.
Keywords: seattle pi; seattle times; a&e; xxxxx; pi; funky; zits; retail; thermomix; more;

Starpulse.com: Starpulse.com - Your Entertainment Destination

Entertainment ... Celebrity. Music. Movies. Television. Photos. Video. Community. Exclusives ... Celebrity Birthdays Feed. Contests Feed. Click here for even ...
Keywords: rihanna; patrick swayze; justin timberlake; beyonce; jennifer lopez; lil wayne; penelope cruz; brad pitt; jessica biel; julia roberts;

Superiorpics.com: SuperiorPics.com

The only site you will ever need for free high quality celebrity pictures and information
Keywords: charlize theron; leslie mann; adriana lima; cristina aguilera; halle; brittany murphy; hillary duff; heather graham; superior pics; heidi klum;
 1 
Other top sites:   cutting-mats.net     ps3portal.sk     culttv.org     child-physical-exam-video.mawexa.net     sushihaccp.com     catholicliturgicals.com   
Recently processed sites:   katadynsurvivor35desalinator.blogspot.com     katadynsurvivor.com     katadyn-trk-drip.buycheapr.com     katadyntrkdripgravidynwaterfilt0sm.blogspot.com     katadynwaterfiltersreview.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9