SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

saveoncommission.com.au
Title: No Commission Real Estate Low Commission Real Estate DIY Sell Low Commission Sydney
Description: Save On Commission offer no commission and low commission real estate service helping Private sellers diy sellers and fsbo save thousands

Site: "saveoncommission.com.au"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: a av


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Commercialrealestate.com.au: Commercial Real Estate.com.au - Real Estate and Property Australia

Comprehensive commercial real estate, industrial, office and retail real estate and property listings Australia wide including Sydney, Melbourne and Brisbane
Keywords: commercial property melbourne; business for sale melbourne; chadstone shopping centre; commercial australia; melbourne commercial real estate; australia commercial property; commercial property for lease melbourne; melbourne commercial property; real estate australia; lease factory;

Domain.com.au:

Keywords: domain com au; domain.com.au; domain com au; domain.com.au; domain.com.au; domain.com.au; www.domain.com.au; domain.com.au; domain com; domain com;

Domainnsw.com.au: Domain Real Estate - NSW

Keywords: domain realestate; realestate nsw;

Domainprincipal.com.au: The Domain Principal Group - Welcome

Keywords: amanda whalen;

Itunes.apple.com: Apple - Download music and more with iTunes. Play it all on iPod.

Learn about iPod, Apple TV, and accessories. Download iTunes software free and purchase iTunes Gift Cards. Check out the most popular TV shows, movies, and music.
Keywords: facebook; netflix; meebo; netlog; twitter; skype; twitter; paypal; flickr; igmail;

Mgiaust.com: MGI Australasia :: Business Solutions Worldwide

Keywords: from australasian business; mgi list;

Propertyguide.com.au:

Keywords: rural australia; australia rural; home for sale in australia; rural property finder; moola bulla;

Realestate.com.au: Real Estate, Property, Land and Homes for Sale, lease and rent ...

Discover how easy it is to save time and money finding the property you want. ... Real Estate Agent Admin. Knowledge Network. Web Design Services. HubOnline ...
Keywords: real estate australia; realestate australia; houses for sale in australia; brisbane rentals; property australia; sydney rentals; accommodation melbourne australia; australian real estate; accommodation gold coast; realestate melbourne;
 1 
Other top sites:   3ctmusic.com     strohmayer.org     parental.qarchive.org     cemchurch.com     balihf.com     stmaryrcchurchlic.blogspot.com   
Recently processed sites:   vacuumcleanerreviews2009.blogspot.com     vacuumcleanerreviews2009.com     vacuumcleanerreviews.aprcardcreditfixedlowrates.com     vacuumcleanerreviewshq.com     vacuumcleanerreviewsmaster.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9