SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

scruffs.us
Title: scruffs - Mobile Dog Grooming
Description: Scruffs mobile dog grooming provides quality, meticulous grooming care for all breeds.

Site: "scruffs.us"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: c cr


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
scruffs
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Gamehouse.com: Download Games & Play Now! > A Free Game Daily! | GameHouse

Free Games at GameHouse! Play a Free Game Daily. Find your favorite Download Games and Online Games. Play the top games now at GameHouse!
Keywords: sudoku; download games; gamehouse; real arcade; zuma deluxe; game; game house; gamehouse.com; realarcade; text twist;

Miniclip.com: Games at Miniclip.com - Play Free Games

New Game Alerts. Games Store. Help. Merchandise. Downloadable Games. Forum. Newsletter ... Welcome to Miniclip.com the largest online games site where you can ...
Keywords: games; game; bubble trouble; free games; pool; free online games; poker games; bubble; mini; sudoku;

Petslovescruffs.com: Scruffs - Luxury Pet Products

Scruffs® have created a collection of luxurious dog bedding, providing comfort for your pet and excellent value for money. From the success of Scruffs® we have launched two sub-brands: Tramps® a collection of pet beds specifically designed for felines, and Freeway® providing both cats & dogs with an impressive choice of leads & collars. To view our f
Keywords: slumber pet bed;

Scruffs.com: Workwear, safety footwear & safety boots — Scruffs Hardwear

Keywords: scruffs workwear; scruffs; high vis waistcoat; pro trousers; anti wicking; black workwear trousers;

Scruffs.co.uk: Scruffs Online Lifestyle Salon :: Top UK Hairdressers Cambridge

Scruffs Lifestyle Hairdressers Cambridge UK Online are an award winning hair salon in the heart of the city of Cambridge. Consistently Voted in the Top 50 Hairdressers in Great Britain.
Keywords: uk hairdressers; hairdressers uk; ukhairdressers; scruffs; uk hair dressers; cambridge hairdressers; scruffs workwear; hairdresser uk; uk hairdressing; hairdressers online;

Thefreedictionary.com: Dictionary, Encyclopedia and Thesaurus - The Free Dictionary

Online Dictionary - Multiple dictionaries including: English dictionary, medical dictionary, legal dictionary, financial dictionary, computer dictionary, thesaurus, dictionary of acronyms and abbreviations, dictionary of idioms, thesaurus, Columbia encyclopedia, Wikipedia encyclopedia, Hutchinson encyclopedia, examples from classic literature, pronunciations, word browser, glossary. Free access
Keywords: piscine; fauteuils; leave; smooch; bares; buffed; accommodation; vitrine; enabled; alternate;

Thescruffs.com: The Scruffs |

The Scruffs presents their newest Album Conquest. Wanna meet the scruffs?
Keywords: scruffs; stephen burns;
 1 
Other top sites:   whitesierra.com     stuarttierneygraphicdesign.com     hackerforever.com     foundationconcerts.com     profed.heartandstroke.ca     ethernetnetworks.org   
Recently processed sites:   fisher-and-paykel.buycheapr.com     fisherandpaykel.cn     fisherandpaykelcooktop.danielcadams.com     fisherandpaykeldishwasher.danielcadams.com     fisherandpaykelfridges.bizrate.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9