SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

simplegarden.com
Title: Simple Garden
Description:

Site: "simplegarden.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: i im


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
simple garden
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Apartmenttherapy.com: Apartment Therapy

Keywords: apartment; big sofa; sofa beds; loft ladder; west elm furniture; parkhaus; west elm; sofabed; loft ladders; toilet brush;

Browse.realsimple.com: Search - Real Simple

Keywords: cleaning; real simple; real simple magazine; real simple recipes; realsimple.com; realsimple; home organizing; simple magazine; bedroom decorating; moving check lists;

Coolhunting.com: Cool Hunting

Cool Hunting is a daily update on ideas and products in the intersection of art, design, culture and technology, and features weekly videos that get an inside look at the people who create them.
Keywords: 20; cream; cool; usb memory stick; cleavage; hori; golden rule; nespresso; wheelie; black swan;

Hgtv.com: HGTV - Decorating, Outdoor Rooms, Landscaping Ideas, Kitchen and Bathroom Design : Home & Garden Television

Transform your home with inspiration and instruction from HGTV for your home design, decorating, landscaping and handmade craft project.
Keywords: home & garden; bathroom; kitchen; hgtv; bathrooms; home improvement; bathroom designs; home and garden; home office; window treatments;

Motherearthnews.com: Organic Gardening, Modern Homesteading, Renewable Energy, Green Homes, Do it Yourself Projects – MOTHER EARTH NEWS

Mother Earth News - The Original Guide to Living Wisely
Keywords: food dehydrators; mother earth; food dehydrator; lpg cars; bricklaying; mother earth news; compact tractor; allergy remedies; natural mosquito repellent; herbal sleep;

Thesimplegarden.com: The Simple Garden - Home

Keywords: simple garden;
 1 
Other top sites:   haroldhead.com     hideoutmedia.com     cutting-mats.net     libranstainedglass.com     lauraromano.net     oneeightyone.com   
Recently processed sites:   bighawk.webs.com     bighaynescreek.webs.com     bighaynescreekwildlifefestival.com     bighazeleyes.com     bighcomputerservices.co.uk   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9